PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00033.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 326aa    MW: 35154.3 Da    PI: 9.7402
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00033.1_g00010.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822221.61.6e-68291621135
                   DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                              gg++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg+kp+  +e++g+sa
  Sme2.5_00033.1_g00010.1  29 GGGRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCVEAGWTVEPDGTTYRKGCKPT-PMEIGGTSA 113
                              689*************************************************************************.********* PP

                   DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsislasaas 135
                              +++p+ss + s+ ss++asp++sy++sp+sssfpsps++d ++++++ s
  Sme2.5_00033.1_g00010.1 114 NITPSSSRHPSPPSSYFASPIPSYQPSPTSSSFPSPSRADANMSSHPYS 162
                              *****************************************98876633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.4E-6330158IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MMWEAGESPA SSGGGVTGAG VPETGGGSGG GRRKPSWRER ENNRRRERRR RAIAAKIYTG  60
LRAQGNYNLP KHCDNNEVLK ALCVEAGWTV EPDGTTYRKG CKPTPMEIGG TSANITPSSS  120
RHPSPPSSYF ASPIPSYQPS PTSSSFPSPS RADANMSSHP YSFLQNVIPP SLPPLRISNS  180
APVTPPLSSP TRHPKQTVNL ETLAKESMFA LNIPFFAASA PASPSRTQRF TPPTIPECDE  240
SDSSTIDSGQ WINFQKYAAN VPPSPTFNLV KPVPPPLHPN DMVTDKGKSI DFNFGNASVK  300
AWQGEKIHDV GFDDLELTLG SGRARR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13150RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3959010.0AF395901.1 Lycopersicon esculentum mature anther-specific protein LAT61 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342599.11e-179PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-115BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-179M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-179(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.29e-96BES1 family protein